E2F-4 Antibody (5B7)

Images

 
Western Blot: E2F-4 Antibody (5B7) [H00001874-M01] - E2F4 monoclonal antibody (M01), clone 5B7 Analysis of E2F4 expression in A-549.
Sandwich ELISA: E2F-4 Antibody (5B7) [H00001874-M01] - Detection limit for recombinant GST tagged E2F4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

E2F-4 Antibody (5B7) Summary

Immunogen
E2F4 (NP_001941 211 a.a. - 301 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ*
Specificity
E2F4 - E2F transcription factor 4, p107/p130-binding
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
E2F4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for E2F-4 Antibody (5B7)

  • E2F transcription factor 4, p107/p130-binding
  • E2F4
  • E2F-4
  • E2F-4p107/p130-binding protein
  • transcription factor E2F4

Background

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-56500
Species: Hu
Applications: ICC/IF
NBP1-80295
Species: Hu
Applications: WB
AF5119
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001874-M01
Species: Hu
Applications: WB, ELISA

Publications for E2F-4 Antibody (H00001874-M01) (0)

There are no publications for E2F-4 Antibody (H00001874-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F-4 Antibody (H00001874-M01) (0)

There are no reviews for E2F-4 Antibody (H00001874-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E2F-4 Antibody (H00001874-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E2F-4 Products

Bioinformatics Tool for E2F-4 Antibody (H00001874-M01)

Discover related pathways, diseases and genes to E2F-4 Antibody (H00001874-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F-4 Antibody (H00001874-M01)

Discover more about diseases related to E2F-4 Antibody (H00001874-M01).
 

Pathways for E2F-4 Antibody (H00001874-M01)

View related products by pathway.

PTMs for E2F-4 Antibody (H00001874-M01)

Learn more about PTMs related to E2F-4 Antibody (H00001874-M01).
 

Research Areas for E2F-4 Antibody (H00001874-M01)

Find related products by research area.

Blogs on E2F-4

There are no specific blogs for E2F-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E2F-4 Antibody (5B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F4
Entrez
OMIM
Uniprot