Recombinant Human DZIP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DZIP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 341-450 of Human DZIP1

Source: Wheat Germ

Amino Acid Sequence: GTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DZIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DZIP1 Protein

  • DAZ interacting protein 1
  • DAZ-interacting protein 1/2
  • DZIP
  • DZIP2
  • DZIPDAZ interacting protein testis1
  • DZIPt1
  • KIAA0996zinc finger DAZ interacting protein 1
  • RP11-23E3.3
  • zinc finger protein DZIP1
  • zinc-finger protein DZIPt1

Background

DZIP1 - DAZ interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
AF1568
Species: Mu
Applications: WB
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-92056
Species: Hu
Applications: IHC, IHC-P
AF196
Species: Mu
Applications: WB, IHC
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow

Publications for DZIP1 Partial Recombinant Protein (H00022873-Q01) (0)

There are no publications for DZIP1 Partial Recombinant Protein (H00022873-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DZIP1 Partial Recombinant Protein (H00022873-Q01) (0)

There are no reviews for DZIP1 Partial Recombinant Protein (H00022873-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DZIP1 Partial Recombinant Protein (H00022873-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DZIP1 Products

Bioinformatics Tool for DZIP1 Partial Recombinant Protein (H00022873-Q01)

Discover related pathways, diseases and genes to DZIP1 Partial Recombinant Protein (H00022873-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DZIP1 Partial Recombinant Protein (H00022873-Q01)

Discover more about diseases related to DZIP1 Partial Recombinant Protein (H00022873-Q01).
 

Pathways for DZIP1 Partial Recombinant Protein (H00022873-Q01)

View related products by pathway.

PTMs for DZIP1 Partial Recombinant Protein (H00022873-Q01)

Learn more about PTMs related to DZIP1 Partial Recombinant Protein (H00022873-Q01).

Blogs on DZIP1

There are no specific blogs for DZIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DZIP1 Antibody
NBP2-31587
GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DZIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DZIP1