dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human dystrophia myotonica containing WD repeat motif. Source: E. coli
Amino Acid Sequence: TYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DMWD |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49622. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen
Background
The gene that codes for DMWD (dystrophia myotonica WD-repeat containing protein) is located in the myotonic dystrophy (DM1) gene cluster on 19q. Mutations in the DM1 region affect DMPK (myotonic dystrophy protein kinase), a myosin kinase expressed in skeletal muscle, and are the cause of myotonic dystrophy, a form of muscular dystrophy characterized by wasting of the muscles and myotonia. DMWD is expressed ubiquitously and is most abundant in the testes and brain. Studies concerning its abundance and sub-cellular localization in brain tissue suggest that it may have a role in some of the mental symptoms associated with myotonic dystrophy. Alternate names for DMWD include DMR-N9, and DM9.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49622PEP) (0)
There are no publications for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49622PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49622PEP) (0)
There are no reviews for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49622PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49622PEP) (0)
Additional dystrophia myotonica containing WD repeat motif Products
Research Areas for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49622PEP)
Find related products by research area.
|
Blogs on dystrophia myotonica containing WD repeat motif