DYRK4 Antibody

Images

 
Western Blot: DYRK4 Antibody [H00008798-D01P] - Analysis of DYRK4 expression in human liver.
Western Blot: DYRK4 Antibody [H00008798-D01P] - Analysis of DYRK4 expression in transfected 293T cell line by DYRK4 polyclonal antibody.Lane 1: DYRK4 transfected lysate(59.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DYRK4 Antibody Summary

Immunogen
DYRK4 (NP_003836.1, 1 a.a. - 520 a.a.) full-length human protein. MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
Specificity
Reacts with dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DYRK4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DYRK4 Antibody

  • dual specificity tyrosine-phosphorylation-regulated kinase 4
  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
  • EC 2.7.12
  • EC 2.7.12.1

Background

Dual-specificity kinases, such as DYRK4, play key roles in cell proliferation, survival, and development (Zhang et al., 2005 [PubMed 15607427]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NB110-94452
Species: Hu, Ch, Mu(-), Rt(-)
Applications: WB, ICC/IF
NBP1-33464
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
AF5409
Species: Hu, Mu, Rt
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4914
Species: Hu
Applications: WB
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56633
Species: Hu
Applications: WB
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for DYRK4 Antibody (H00008798-D01P) (0)

There are no publications for DYRK4 Antibody (H00008798-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYRK4 Antibody (H00008798-D01P) (0)

There are no reviews for DYRK4 Antibody (H00008798-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DYRK4 Antibody (H00008798-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYRK4 Products

Bioinformatics Tool for DYRK4 Antibody (H00008798-D01P)

Discover related pathways, diseases and genes to DYRK4 Antibody (H00008798-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYRK4 Antibody (H00008798-D01P)

Discover more about diseases related to DYRK4 Antibody (H00008798-D01P).
 

Pathways for DYRK4 Antibody (H00008798-D01P)

View related products by pathway.

PTMs for DYRK4 Antibody (H00008798-D01P)

Learn more about PTMs related to DYRK4 Antibody (H00008798-D01P).
 

Research Areas for DYRK4 Antibody (H00008798-D01P)

Find related products by research area.

Blogs on DYRK4

There are no specific blogs for DYRK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYRK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK4
Entrez
Uniprot