We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DYRK1A Recombinant Protein Antigen

Images

 
There are currently no images for DYRK1A Protein (NBP1-84031PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DYRK1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DYRK1A.

Source: E. coli

Amino Acid Sequence: HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DYRK1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84031.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DYRK1A Recombinant Protein Antigen

  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  • DYRK1
  • DYRK1A
  • MNBEC 2.7.110EC 2.7.12
  • MNBH

Background

DYRK1A encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-33464
Species: Hu, Mu
Applications: ICC/IF, WB
MAB5408
Species: Hu, Rt
Applications: IHC, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-46853
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-92589
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5409
Species: Hu, Mu, Rt
Applications: WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB110-60491
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-87194
Species: Hu
Applications: WB
NBP1-84031PEP
Species: Hu
Applications: AC

Publications for DYRK1A Protein (NBP1-84031PEP) (0)

There are no publications for DYRK1A Protein (NBP1-84031PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYRK1A Protein (NBP1-84031PEP) (0)

There are no reviews for DYRK1A Protein (NBP1-84031PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DYRK1A Protein (NBP1-84031PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DYRK1A Products

Research Areas for DYRK1A Protein (NBP1-84031PEP)

Find related products by research area.

Blogs on DYRK1A

There are no specific blogs for DYRK1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DYRK1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK1A