Dynorphin Antibody (2E12)

Images

 
Western Blot: Dynorphin Antibody (2E12) [H00005173-M01] - Analysis of PDYN expression in transfected 293T cell line by PDYN monoclonal antibody (M01), clone 2E12.Lane 1: PDYN transfected lysate(28.4 KDa).Lane 2: ...read more
Immunoprecipitation: Dynorphin Antibody (2E12) [H00005173-M01] - Analysis of PDYN transfected lysate using anti-PDYN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PDYN MaxPab rabbit polyclonal ...read more
Sandwich ELISA: Dynorphin Antibody (2E12) [H00005173-M01] - Detection limit for recombinant GST tagged PDYN is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
2E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dynorphin Antibody (2E12) Summary

Immunogen
PDYN (NP_077722.1, 205 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
Specificity
PDYN - prodynorphin (2E12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDYN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 5
using
H00005173-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dynorphin Antibody (2E12)

  • ADCA
  • Beta-neoendorphin-dynorphin
  • leu-enkephalin
  • leumorphin
  • MGC26418
  • PENKB
  • preprodynorphin
  • preproenkephalin B
  • prodynorphin
  • proenkephalin-B
  • rimorphin
  • SCA23
  • spinocerebellar ataxia 23

Background

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00005179-M04
Species: Hu
Applications: ELISA, S-ELISA, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
MAB38951
Species: Hu
Applications: IHC
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005173-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for Dynorphin Antibody (H00005173-M01) (0)

There are no publications for Dynorphin Antibody (H00005173-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Dynorphin Antibody (H00005173-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005173-M01:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Dynorphin H00005173-M01
Enlarge
5
reviewed by:
Michael Nowak
Western Blot Human 11/23/2021
View

Summary

ApplicationWestern Blot
Sample TestedBrain tissue lysate
SpeciesHuman
Lot2E12

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dynorphin Antibody (H00005173-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dynorphin Products

Bioinformatics Tool for Dynorphin Antibody (H00005173-M01)

Discover related pathways, diseases and genes to Dynorphin Antibody (H00005173-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dynorphin Antibody (H00005173-M01)

Discover more about diseases related to Dynorphin Antibody (H00005173-M01).
 

Pathways for Dynorphin Antibody (H00005173-M01)

View related products by pathway.

PTMs for Dynorphin Antibody (H00005173-M01)

Learn more about PTMs related to Dynorphin Antibody (H00005173-M01).
 

Research Areas for Dynorphin Antibody (H00005173-M01)

Find related products by research area.

Blogs on Dynorphin

There are no specific blogs for Dynorphin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Michael Nowak
11/23/2021
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol PDYN
Entrez
Uniprot