Recombinant Human DYNC1H1 GST (N-Term) Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human DYNC1H1 Source: Wheat Germ (in vitro) Amino Acid Sequence: MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
DYNC1H1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
48.6 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human DYNC1H1 GST (N-Term) Protein
Background
The DYNC1H1 gene encodes a cytoplasmic dynein 1 heavy chain 1 protein that is 4,646 amino acids long at 532 kDA. Dyneines function as molecular motors that contain ATPase activity. Defects in DYNC1H1 cause Charcot-Marie-Tooth Disease type 2O (CMT2O), mental retardation autosomal dominant type 13 (MRD13), as well as spinal muscular atrophy, lower extremity, autosomal dominant (SMALED). DYNC1H1 has also been investigated by researchers in myeloma, neuropathy, ciliary dyskinesia, lateral sclerosis, intellectual disabilities, lissencephaly, schizophrenia, malaria, and neurodegeneration. DYNC1H1 participates in centrosome maturation, adaptive immune system, cytoplasmic microtubules, cell cycle spindle assembly and chromosome separation, as well as phagosome and vasopressin-regulated water reabsorption. DYNC1H1 interacts with genes HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H43.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for DYNC1H1 Recombinant Protein (H00001778-P01) (0)
There are no publications for DYNC1H1 Recombinant Protein (H00001778-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DYNC1H1 Recombinant Protein (H00001778-P01) (0)
There are no reviews for DYNC1H1 Recombinant Protein (H00001778-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DYNC1H1 Recombinant Protein (H00001778-P01) (0)
Additional DYNC1H1 Products
Research Areas for DYNC1H1 Recombinant Protein (H00001778-P01)
Find related products by research area.
|
Blogs on DYNC1H1