Recombinant Human DYNC1H1 GST (N-Term) Protein

SDS-Page: Recombinant Human DYNC1H1 Protein [H00001778-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human DYNC1H1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human DYNC1H1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: DYNC1H1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 48.6 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DYNC1H1 GST (N-Term) Protein

• cytoplasmic dynein 1 heavy chain 1
• Cytoplasmic dynein heavy chain 1
• DHC1a
• DHC1Dynein heavy chain, cytosolic
• DKFZp686P2245
• Dnchc1
• DNCLDNCH1
• DNECLDYHC
• dynein, cytoplasmic 1, heavy chain 1
• dynein, cytoplasmic, heavy polypeptide 1
• HL-3
• KIAA0325
• p22

Background

The DYNC1H1 gene encodes a cytoplasmic dynein 1 heavy chain 1 protein that is 4,646 amino acids long at 532 kDA. Dyneines function as molecular motors that contain ATPase activity. Defects in DYNC1H1 cause Charcot-Marie-Tooth Disease type 2O (CMT2O), mental retardation autosomal dominant type 13 (MRD13), as well as spinal muscular atrophy, lower extremity, autosomal dominant (SMALED). DYNC1H1 has also been investigated by researchers in myeloma, neuropathy, ciliary dyskinesia, lateral sclerosis, intellectual disabilities, lissencephaly, schizophrenia, malaria, and neurodegeneration. DYNC1H1 participates in centrosome maturation, adaptive immune system, cytoplasmic microtubules, cell cycle spindle assembly and chromosome separation, as well as phagosome and vasopressin-regulated water reabsorption. DYNC1H1 interacts with genes HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H43.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DYNC1H1