DUSP7 Antibody - BSA Free

Western Blot: DUSP7 Antibody [NBP3-10614] - Western blot analysis of DUSP7 in Rat Pancreas lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DUSP7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DUSP7 Antibody - BSA Free (NBP3-10614) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat DUSP7 (XP_238551). Peptide sequence ATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCET
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DUSP7 Antibody - BSA Free

• DKFZp586F2224
• dual specificity phosphatase 7
• Dual specificity protein phosphatase PYST2
• dual-specificity phosphatase-7
• EC 3.1.3.16
• EC 3.1.3.48
• MKPX
• MKP-X
• PYST2dual specificity protein phosphatase 7

Background

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-basedprotein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosineand serine/threonine residues. DUSP7 belongs to a class of DUSPs, designated MKPs, that dephosphorylate MAPK(mitogen-activated protein kinase) proteins ERK (see MIM 601795), JNK (see MIM 601158), and p38 (see MIM 600289) withspecificity distinct from that of individual MKP proteins. MKPs contain a highly conserved C-terminal catalytic domainand an N-terminal Cdc25 (see MIM 116947)-like (CH2) domain. MAPK activation cascades mediate various physiologicprocesses, including cellular proliferation, apoptosis, differentiation, and stress responses (summary by Patterson etal., 2009 (PubMed 19228121)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP7