DUSP26 Antibody - BSA Free

Western Blot: DUSP26 Antibody [NBP2-84834] - Host: Rabbit. Target Name: DUSP26. Sample Tissue: Mouse Testis lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DUSP26 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse DUSP26. Peptide sequence: TACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHNRWRGTPEAY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DUSP26 Antibody - BSA Free

• DSP-4
• dual specificity phosphatase 26 (putative)
• Dual specificity phosphatase SKRP3
• dual specificity protein phosphatase 26
• dual-specificity phosphatase SKRP3
• DUSP24SKRP3
• EC 3.1.3.16
• EC 3.1.3.48
• LDP4
• LDP-4
• Low-molecular-mass dual-specificity phosphatase 4
• MAP kinase phosphatase 8
• MGC1136
• MGC2627
• Mitogen-activated protein kinase phosphatase 8
• MKP8
• MKP-8
• NATA1
• Novel amplified gene in thyroid anaplastic cancer

Background

MGC1136 is classified as a dual specificity MAP kinase phosphatase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP26