Home » DUSP13 » DUSP13 Antibodies » DUSP13 Antibody

DUSP13 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DUSP13 Antibody [NBP2-86621] - WB Suggested Anti-DS13B antibody Titration: 1 ug/mL. Sample Type: Human 721_B Whole Cell
Western Blot: DUSP13 Antibody [NBP2-86621] - WB Suggested Anti-DS13B antibody Titration: 1 ug/mL. Sample Type: Human 721_B Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DUSP13 Antibody Summary

Immunogen
The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP13. Peptide sequence: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP13 Antibody

  • Branching-enzyme interacting DSP
  • dual specificity phosphatase 13
  • Dual specificity phosphatase SKRP4
  • dual specificity protein phosphatase 13 isoform MDSP
  • dual specificity protein phosphatase 13
  • dual-specificity phosphatase SKRP4
  • DUSP13A
  • DUSP13B
  • EC 3.1.3.16
  • EC 3.1.3.48
  • FLJ32450
  • MDSPbranching-enzyme interacting dual-specificity protein phosphatase
  • Muscle-restricted DSP
  • Testis- and skeletal-muscle-specific DSP
  • TMDPBEDPSKRP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Desmoplakin
Antibody (824038) [Un ...
MAB9080
Western blot shows lysate of COLO 205 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Desmoplakin Monoclonal Antibody (Catalog # MAB9080) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for Desmoplakin at approximately 260 and 330 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
DSPP Antibody
NBP2-92546
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of H9C2 cells using DSPP . Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of L929 cells using DSPP . Blue: DAPI for nuclear staining.
Western Blot: DSPP Antibody [NBP2-92546] - Analysis of extracts of various cell lines, using DSPP at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
VHR/DUSP3 Antibody
(237020)
MAB1654
Western blot shows lysates of TE-85 human osteogenic sarcoma cell line, TF-1 human erythroleukemic cell line, and C2C12 mouse myoblast cell line . PVDF membrane was probed with 0.5 µg/mL Mouse Anti-Human/Mouse/Rat VHR Monoclonal Antibody (Catalog # MAB1654) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). For additional reference, Recombinant Human VHR (Catalog # 1654-VH) (2 ng) was included. A specific band for VHR was detected at approximately 24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
DUSP12 Antibody
H00011266-D01P
Western Blot: DUSP12 Antibody [H00011266-D01P] - Analysis of DUSP12 expression in transfected 293T cell line by DUSP12 polyclonal antibody.Lane 1: DUSP12 transfected lysate(37.70 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: DUSP12 Antibody [H00011266-D01P] - Analysis of antibody to DUSP12 on HeLa cell. Antibody concentration 20 ug/ml.
Species: Hu
Applications: ICC/IF, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
DUSP5 Antibody
(2F3)
H00001847-M04
Western Blot: DUSP5 Antibody (2F3) [H00001847-M04] - Analysis of DUSP5 expression in transfected 293T cell line by DUSP5 monoclonal antibody (M04), clone 2F3. Lane 1: DUSP5 transfected lysate (Predicted MW: 42.1 KDa). Lane 2: Non-transfected lysate.
Western Blot: DUSP5 Antibody (2F3) [H00001847-M04] - Western Blot analysis of DUSP5 expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/Immunofluorescence: DUSP5 Antibody (2F3) [H00001847-M04] - Analysis of monoclonal antibody to DUSP5 on HeLa cell. Antibody concentration 10 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
CDC25C Antibody
NBP2-89147
Western Blot: CDC25C Antibody [NBP2-89147] - Analysis of Cdc25C on human skin tissue lysate using anti-Cdc25C antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: CDC25C Antibody [NBP2-89147] - Staining Cdc25C in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: CDC25C Antibody [NBP2-89147] - Staining Cdc25C in HUVEC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RASGRF1 Antibody
NBP1-85727
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
(3 Reviews)
(26 Publications)
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot: AHSA1 Antibody (1A2-A8) [H00010598-M01] - AHSA1 monoclonal antibody (M01), clone 1A2-A8 Analysis of AHSA1 expression in HepG2.
Sandwich ELISA: AHSA1 Antibody (1A2-A8) [H00010598-M01] - Detection limit for recombinant GST tagged AHSA1 is 3 ng/ml as a capture antibody.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Crk Antibody
(3G11E8)
NBP2-37568
ELISA: Crk Antibody (3G11E8) [NBP2-37568] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against human CRK (AA: 1-204) recombinant protein. (Expected MW is 48.4 kDa)
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - Analysis of Jurkat cells, using anti-GRAP2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GRAP2 antibody, and then analyzed by flow cytometry.
Western Blot: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GRAP2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GRAP2.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot: POLDIP2 Antibody [NBP1-68874] - Staining of K562 (A), MCF7 (B) and Mouse Liver (C) lysates (35ug protein in RIPA buffer). Primary incubation was overnight at 4C. Detected by chemiluminescence.
Western Blot: POLDIP2 Antibody [NBP1-68874] - (1ug/ml) Analysis of MCF7 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and p38 alpha knockout HEK293T cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for p38 alpha at approximately 38 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Orexin B, p38 alpha , and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
DUSP13 Antibody
NBP2-86621
DUSP13 Antibody
Species: Hu
Applications: WB

Publications for DUSP13 Antibody (NBP2-86621) (0)

There are no publications for DUSP13 Antibody (NBP2-86621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP13 Antibody (NBP2-86621) (0)

There are no reviews for DUSP13 Antibody (NBP2-86621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP13 Antibody (NBP2-86621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP13 Products

Bioinformatics Tool for DUSP13 Antibody (NBP2-86621)

Discover related pathways, diseases and genes to DUSP13 Antibody (NBP2-86621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP13 Antibody (NBP2-86621)

Discover more about diseases related to DUSP13 Antibody (NBP2-86621).
 

Pathways for DUSP13 Antibody (NBP2-86621)

View related products by pathway.

PTMs for DUSP13 Antibody (NBP2-86621)

Learn more about PTMs related to DUSP13 Antibody (NBP2-86621).
 

Research Areas for DUSP13 Antibody (NBP2-86621)

Find related products by research area.

Blogs on DUSP13

There are no specific blogs for DUSP13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP13 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DUSP13