DUSP13 Antibody

Images

 
Western Blot: DUSP13 Antibody [NBP2-86621] - WB Suggested Anti-DS13B antibody Titration: 1 ug/mL. Sample Type: Human 721_B Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP13 Antibody Summary

Immunogen
The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP13. Peptide sequence: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP13 Antibody

  • Branching-enzyme interacting DSP
  • dual specificity phosphatase 13
  • Dual specificity phosphatase SKRP4
  • dual specificity protein phosphatase 13 isoform MDSP
  • dual specificity protein phosphatase 13
  • dual-specificity phosphatase SKRP4
  • DUSP13A
  • DUSP13B
  • EC 3.1.3.16
  • EC 3.1.3.48
  • FLJ32450
  • MDSPbranching-enzyme interacting dual-specificity protein phosphatase
  • Muscle-restricted DSP
  • Testis- and skeletal-muscle-specific DSP
  • TMDPBEDPSKRP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB9080
Species: Hu
Applications: WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB1654
Species: Hu, Mu, Rt
Applications: WB
H00011266-D01P
Species: Hu
Applications: ICC/IF, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00001847-M04
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-89147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-86621
Species: Hu
Applications: WB

Publications for DUSP13 Antibody (NBP2-86621) (0)

There are no publications for DUSP13 Antibody (NBP2-86621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP13 Antibody (NBP2-86621) (0)

There are no reviews for DUSP13 Antibody (NBP2-86621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP13 Antibody (NBP2-86621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP13 Products

Bioinformatics Tool for DUSP13 Antibody (NBP2-86621)

Discover related pathways, diseases and genes to DUSP13 Antibody (NBP2-86621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP13 Antibody (NBP2-86621)

Discover more about diseases related to DUSP13 Antibody (NBP2-86621).
 

Pathways for DUSP13 Antibody (NBP2-86621)

View related products by pathway.

PTMs for DUSP13 Antibody (NBP2-86621)

Learn more about PTMs related to DUSP13 Antibody (NBP2-86621).
 

Research Areas for DUSP13 Antibody (NBP2-86621)

Find related products by research area.

Blogs on DUSP13

There are no specific blogs for DUSP13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP13