DUSP13 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DUSP13 Antibody - BSA Free (NBP2-86620) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DUSP13. Peptide sequence: DRRLKASSTNCPSEKCTAWARYSHRMDSLQKQDLRRPKIHGAVQASPYQP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DUSP13B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DUSP13 Antibody - BSA Free
Background
Official Gene Symbol: DUSP13 Gen Bank Accession Number: NP_001007274 Gene ID: 51207 (Human) Gene Map Locus: 10q22.2 (Human) DUSP13, a novel DSP, is a member of highly conserved Protein-tyrosine phosphatase super family. Members of this family cooperate with protein kinases and play a vital role in cell cycle regulation. DUSP13 consists of a conserved catalytic domain and is expressed specifically in the testis and skeletal muscle. Based on mRNA localization and expression studies during development, DUSP13 is suggested to be expressed as 3 isoforms due to alternative splicing. Reports suggest DUSP13 might be involved in the regulation of meiosis and differentiation of testicular germ cells during spermatogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: WB
Publications for DUSP13 Antibody (NBP2-86620) (0)
There are no publications for DUSP13 Antibody (NBP2-86620).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DUSP13 Antibody (NBP2-86620) (0)
There are no reviews for DUSP13 Antibody (NBP2-86620).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DUSP13 Antibody (NBP2-86620) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DUSP13 Products
Research Areas for DUSP13 Antibody (NBP2-86620)
Find related products by research area.
|
Blogs on DUSP13