DUSP11 Antibody


Western Blot: DUSP11 Antibody [NBP1-68919] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

DUSP11 Antibody Summary

Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Dusp11 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DUSP11 Antibody

  • dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
  • Dual specificity protein phosphatase 11
  • EC 3.1.3.-
  • Phosphatase that interacts with RNA/RNP complex 1
  • PIR1RNA/RNP complex-interacting phosphatase
  • RNA/RNP complex-1-interacting phosphatase
  • serine/threonine specific protein phosphatase


It has both, RNA 5'-diphosphatase and 5'-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to RNA. Dusp11 may participate in nuclear mRNA metabolism.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: WB

Publications for DUSP11 Antibody (NBP1-68919) (0)

There are no publications for DUSP11 Antibody (NBP1-68919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP11 Antibody (NBP1-68919) (0)

There are no reviews for DUSP11 Antibody (NBP1-68919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP11 Antibody (NBP1-68919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DUSP11 Products

Bioinformatics Tool for DUSP11 Antibody (NBP1-68919)

Discover related pathways, diseases and genes to DUSP11 Antibody (NBP1-68919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP11 Antibody (NBP1-68919)

Discover more about diseases related to DUSP11 Antibody (NBP1-68919).

Pathways for DUSP11 Antibody (NBP1-68919)

View related products by pathway.

PTMs for DUSP11 Antibody (NBP1-68919)

Learn more about PTMs related to DUSP11 Antibody (NBP1-68919).

Blogs on DUSP11

There are no specific blogs for DUSP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DUSP11 Antibody and receive a gift card or discount.


Gene Symbol DUSP11