DPPII/QPP/DPP7 Recombinant Protein Antigen

Images

 
There are currently no images for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DPPII/QPP/DPP7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DPPII/QPP/DPP7.

Source: E.coli

Amino Acid Sequence: SNGNLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DPP7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55799 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DPPII/QPP/DPP7 Recombinant Protein Antigen

  • carboxytripeptidase
  • Dipeptidyl aminopeptidase II
  • dipeptidyl arylamidase II
  • dipeptidyl peptidase 2
  • Dipeptidyl peptidase 7
  • Dipeptidyl peptidase II
  • dipeptidylpeptidase 7
  • dipeptidyl-peptidase 7
  • dipeptidyl-peptidase II
  • DPP II
  • DPP2
  • DPP7
  • DPPII
  • EC 3.4.14.2
  • QPP
  • Quiescent cell proline dipeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-84993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002191-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01521
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-55799PEP
Species: Hu
Applications: AC

Publications for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP) (0)

There are no publications for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP) (0)

There are no reviews for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DPPII/QPP/DPP7 Products

Bioinformatics Tool for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP)

Discover related pathways, diseases and genes to DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP)

Discover more about diseases related to DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP).
 

Pathways for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP)

View related products by pathway.

PTMs for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP)

Learn more about PTMs related to DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP).
 

Research Areas for DPPII/QPP/DPP7 Recombinant Protein Antigen (NBP2-55799PEP)

Find related products by research area.

Blogs on DPPII/QPP/DPP7

There are no specific blogs for DPPII/QPP/DPP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DPPII/QPP/DPP7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP7
Entrez