We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DPP10 Recombinant Protein Antigen

Images

 
There are currently no images for DPP10 Protein (NBP2-13936PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DPP10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DPP10.

Source: E. coli

Amino Acid Sequence: GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DPP10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13936.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DPP10 Recombinant Protein Antigen

  • dipeptidyl peptidase 10
  • Dipeptidyl peptidase IV-related protein 3
  • dipeptidyl peptidase like protein 2
  • Dipeptidyl peptidase X
  • Dipeptidyl peptidase-like protein 2
  • dipeptidyl-peptidase 10 (non-functional)
  • dipeptidyl-peptidase 10
  • DPL2
  • DPP X
  • DPP10
  • DPPY
  • DPRP3
  • DPRP-3
  • DPRP3dipeptidylpeptidase 10
  • inactive dipeptidyl peptidase 10
  • KIAA1492

Background

DPP10 is a novel gene, DPP10, encodes a homolog of dipeptidyl peptidases (DPPs) that cleave terminal dipeptides from cytokines and chemokines, and it presents a potential new target for asthma therapy. The DPP10 protein shares features with members of the S9B family of DPP serine proteases, which includes DPP4, a widely expressed enzyme that plays a central role in chemokine processing as part of the innate immune system. The locus displays a complex pattern of transcript splicing, with eight alternate first exons; four of which localize within the LD block strongly associated with asthma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2360
Applications: CyTOF-ready, Flow, IP
AF1180
Applications: ICC, IHC, Simple Western, WB
NBP3-38467
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-44315
Species: Ha, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
NBP2-01830
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-01521
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF3715
Applications: Dual ISH-IHC, IHC, IP, KO, Simple Western, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP3-03744
Species: Hu, Mu, Rt
Applications: WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-31928
Species: Hu
Applications: IHC,  IHC-P
NBP1-88502
Species: Hu
Applications: IHC,  IHC-P
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DY413
Applications: ELISA
NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-13936PEP
Species: Hu
Applications: AC

Publications for DPP10 Protein (NBP2-13936PEP) (0)

There are no publications for DPP10 Protein (NBP2-13936PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP10 Protein (NBP2-13936PEP) (0)

There are no reviews for DPP10 Protein (NBP2-13936PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DPP10 Protein (NBP2-13936PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DPP10 Products

Blogs on DPP10

There are no specific blogs for DPP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DPP10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP10