DNA Polymerase iota Antibody (8G9) Summary
| Immunogen |
POLI (AAH32662, 616 a.a. ~ 716 a.a) partial recombinant protein with GST tag.PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVA TDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKEL LAEWKRAGSDFHIGHK |
| Localization |
Nuclear |
| Specificity |
POLI - polymerase (DNA directed) iota |
| Isotype |
IgG3 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
POLI |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
Phosphate buffered saline, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DNA Polymerase iota Antibody (8G9)
Background
DNA Polymerase Iota, also known as Rad30B, is a novel human polymerase, unlike any others known. It is an extremely low fidelity enzyme that is highly error prone when replicating undamaged and damaged DNA in vitro. To date there is, however, no human disease that can be attributed to overexpression or defects in DNA Polymerase Iota.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB, ELISA
Publications for DNA Polymerase iota Antibody (H00011201-M01)(3)
Showing Publications 1 -
3 of 3.
| Publications using H00011201-M01 |
Applications |
Species |
| Sekimoto T, Oda T, Kurashima K et al. Both High-fidelity Replicative and Low-fidelity Y-family Polymerases are Involved in DNA Rereplication. Mol Cell Biol. 2014-12-08 [PMID: 25487575] |
|
|
| Takezawa J, Ishimi Y, Aiba N, Yamada K. Rev1, Rev3, or Rev7 siRNA Abolishes Ultraviolet Light-Induced Translesion Replication in HeLa Cells: A Comprehensive Study Using Alkaline Sucrose Density Gradient Sedimentation. J Nucleic Acids. 2010-12-01 [PMID: 21151666] |
|
|
| Wang Y, Woodgate R, McManus TP et al. Evidence that in xeroderma pigmentosum variant cells, which lack DNA polymerase eta, DNA polymerase iota causes the very high frequency and unique spectrum of UV-induced mutations. Cancer Res. 2007-04-01 [PMID: 17409408] |
|
|
Reviews for DNA Polymerase iota Antibody (H00011201-M01) (0)
There are no reviews for DNA Polymerase iota Antibody (H00011201-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNA Polymerase iota Antibody (H00011201-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNA Polymerase iota Products
Research Areas for DNA Polymerase iota Antibody (H00011201-M01)
Find related products by research area.
|
Blogs on DNA Polymerase iota