Recombinant Human DLG1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DLG1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human DLG1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DLG1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DLG1 Protein

  • discs, large homolog 1 (Drosophila)
  • disks large homolog 1
  • DKFZp761P0818
  • DKFZp781B0426
  • hDlg
  • large (Drosophila) homolog 1
  • presynaptic protein SAP97

Background

DLG1 - discs, large homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NB300-546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00003996-M01
Species: Hu
Applications: WB, ELISA
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
H00001739-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DLG1 Partial Recombinant Protein (H00001739-Q01) (0)

There are no publications for DLG1 Partial Recombinant Protein (H00001739-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLG1 Partial Recombinant Protein (H00001739-Q01) (0)

There are no reviews for DLG1 Partial Recombinant Protein (H00001739-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLG1 Partial Recombinant Protein (H00001739-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DLG1 Products

Bioinformatics Tool for DLG1 Partial Recombinant Protein (H00001739-Q01)

Discover related pathways, diseases and genes to DLG1 Partial Recombinant Protein (H00001739-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLG1 Partial Recombinant Protein (H00001739-Q01)

Discover more about diseases related to DLG1 Partial Recombinant Protein (H00001739-Q01).
 

Pathways for DLG1 Partial Recombinant Protein (H00001739-Q01)

View related products by pathway.

PTMs for DLG1 Partial Recombinant Protein (H00001739-Q01)

Learn more about PTMs related to DLG1 Partial Recombinant Protein (H00001739-Q01).
 

Research Areas for DLG1 Partial Recombinant Protein (H00001739-Q01)

Find related products by research area.

Blogs on DLG1

There are no specific blogs for DLG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DLG1 Antibody
NB600-1229
APC Antibody
NB100-91662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DLG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DLG1