DLG1 Antibody (1D8)

Proximity Ligation Assay: DLG1 Antibody (1D8) [H00001739-M01] - Analysis of protein-protein interactions between LCK and DLG1. HeLa cells were stained with anti-LCK rabbit purified polyclonal 1:1200 and anti-DLG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

DLG1 Antibody (1D8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
• Specificity: DLG1 - discs, large homolog 1 (Drosophila) (1D8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DLG1
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Proximity Ligation Assay
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLG1 Antibody (1D8)

• discs, large homolog 1 (Drosophila)
• disks large homolog 1
• DKFZp761P0818
• DKFZp781B0426
• hDlg
• large (Drosophila) homolog 1
• presynaptic protein SAP97

Background

DLG1(disks large homolog 1), also known as SAP97(synapse-associated protein 97), is a scaffolding protein that contains three PDZ domains, one SH3 domain, one L27 domain, and one guanylate kinase-like domain. DLG1has been found to control ion channel clustering at post-synaptic densities in neural cells and to also play a role in adherens junction assembly, and the recruitment of signaling molecules to discreet plasma membrane domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLG1
• OMIM:
  • 601014(Human)