DIS3 Antibody - BSA Free

Images

 
Genetic Strategies: Western Blot: DIS3 Antibody [NBP1-85209] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Western Blot: DIS3 Antibody [NBP1-85209] - Analysis in human cell line U-87 MG.
Immunocytochemistry/ Immunofluorescence: DIS3 Antibody [NBP1-85209] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green
Immunohistochemistry-Paraffin: DIS3 Antibody [NBP1-85209] -Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: DIS3 Antibody [NBP1-85209] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: DIS3 Antibody [NBP1-85209] - Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: DIS3 Antibody [NBP1-85209] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
     

Genetic Strategies

   

Order Details

View Available Formulations
Catalog# & Formulation Size Price

DIS3 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit DIS3 Antibody - BSA Free (NBP1-85209) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DIS3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIS3 Protein (NBP1-85209PEP)
Publications
Read Publication using NBP1-85209.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24150935), Rat (87%), Mouse (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIS3 Antibody - BSA Free

  • 2810028N01Rik
  • DIS3 mitotic control homolog (S. cerevisiae)
  • dis3p
  • DKFZp667L1817
  • EC 3.1.13
  • EC 3.1.13.-
  • EC 3.1.26.-
  • EXOSC11
  • exosome complex exonuclease RRP44
  • exosome component 11
  • FLJ10484
  • KIAA1008RP11-342J4.3
  • MGC33035
  • mitotic control protein dis3 homolog
  • Protein DIS3 homolog
  • Ribosomal RNA-processing protein 44
  • RRP44bA555G22.1

Background

DIS3 is a component of the exosome 3'->5' exoribonuclease complex. Required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. Also associated with the GTPase Ran. Has a 3'-5' exonuclease activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82448
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-82170
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-48615
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82485
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85092
Species: Hu
Applications: IHC,  IHC-P, WB
943-D3
Species: Hu
Applications: Bind
NBP3-47457
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
AF4629
Species: Hu
Applications: WB
NBP2-46383
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94200
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-13486
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-47466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1574
Species: Hu, Mu
Applications: ICC, IHC,  IHC-P, IP, KD, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP3-45287
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP1-85209
Species: Hu
Applications: WB, ICC/IF, IHC, KD

Publications for DIS3 Antibody (NBP1-85209)(1)

Reviews for DIS3 Antibody (NBP1-85209) (0)

There are no reviews for DIS3 Antibody (NBP1-85209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIS3 Antibody (NBP1-85209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIS3 Products

Research Areas for DIS3 Antibody (NBP1-85209)

Find related products by research area.

Blogs on DIS3

There are no specific blogs for DIS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIS3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DIS3