DIS3 Antibody

Images

 
Western Blot: DIS3 Antibody [NBP1-85209] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DIS3 Antibody [NBP1-85209] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: DIS3 Antibody [NBP1-85209] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Western Blot: DIS3 Antibody [NBP1-85209] - Analysis in human cell line U-87 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIS3 Protein (NBP1-85209PEP)
Publications
Read Publication using NBP1-85209.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24150935)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIS3 Antibody

  • 2810028N01Rik
  • DIS3 mitotic control homolog (S. cerevisiae)
  • dis3p
  • DKFZp667L1817
  • EC 3.1.13
  • EC 3.1.13.-
  • EC 3.1.26.-
  • EXOSC11
  • exosome complex exonuclease RRP44
  • exosome component 11
  • FLJ10484
  • KIAA1008RP11-342J4.3
  • MGC33035
  • mitotic control protein dis3 homolog
  • Protein DIS3 homolog
  • Ribosomal RNA-processing protein 44
  • RRP44bA555G22.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85092
Species: Hu
Applications: WB, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP2-57026
Species: Hu
Applications: ICC/IF
NBP2-20728
Species: Hu
Applications: WB
NBP2-13486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006904-B01
Species: Hu
Applications: WB
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DIS3 Antibody (NBP1-85209)(1)

Reviews for DIS3 Antibody (NBP1-85209) (0)

There are no reviews for DIS3 Antibody (NBP1-85209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIS3 Antibody (NBP1-85209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIS3 Products

Bioinformatics Tool for DIS3 Antibody (NBP1-85209)

Discover related pathways, diseases and genes to DIS3 Antibody (NBP1-85209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIS3 Antibody (NBP1-85209)

Discover more about diseases related to DIS3 Antibody (NBP1-85209).
 

Pathways for DIS3 Antibody (NBP1-85209)

View related products by pathway.

PTMs for DIS3 Antibody (NBP1-85209)

Learn more about PTMs related to DIS3 Antibody (NBP1-85209).

Blogs on DIS3

There are no specific blogs for DIS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIS3