Recombinant Human DHX38 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DHX38 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 342-450 of Human DHX38 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DHX38
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DHX38 Protein

  • ATP-dependent RNA helicase DHX38
  • DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38
  • DEAH (Asp-Glu-Ala-His) box polypeptide 38
  • DEAH box protein 38
  • EC 3.6.1
  • EC 3.6.4.13
  • KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16
  • PRP16 homolog of S.cerevisiae
  • PRP16hPrp16
  • PRPF16

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-586
Species: Hu
Applications: WB, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-81801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-92138
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for DHX38 Partial Recombinant Protein (H00009785-Q01) (0)

There are no publications for DHX38 Partial Recombinant Protein (H00009785-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX38 Partial Recombinant Protein (H00009785-Q01) (0)

There are no reviews for DHX38 Partial Recombinant Protein (H00009785-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX38 Partial Recombinant Protein (H00009785-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DHX38 Products

Bioinformatics Tool for DHX38 Partial Recombinant Protein (H00009785-Q01)

Discover related pathways, diseases and genes to DHX38 Partial Recombinant Protein (H00009785-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX38 Partial Recombinant Protein (H00009785-Q01)

Discover more about diseases related to DHX38 Partial Recombinant Protein (H00009785-Q01).
 

Pathways for DHX38 Partial Recombinant Protein (H00009785-Q01)

View related products by pathway.

PTMs for DHX38 Partial Recombinant Protein (H00009785-Q01)

Learn more about PTMs related to DHX38 Partial Recombinant Protein (H00009785-Q01).

Blogs on DHX38

There are no specific blogs for DHX38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DHX38 Antibody
NBP1-85269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DHX38 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX38