DGCR6 Antibody

Images

 
Western Blot: DGCR6 Antibody [NBP2-84003] - Host: Rabbit. Target Name: DGCR6. Sample Tissue: Human Lung Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGCR6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DGCR6. Peptide sequence: REEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DGCR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGCR6 Antibody

  • DiGeorge syndrome critical region 6
  • DiGeorge syndrome critical region gene 6
  • DiGeorge syndrome critical region protein 6
  • protein DGCR6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2832
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00023119-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-92215
Species: Hu, Mu, Rt
Applications: WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-54724
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33120
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-04894
Species: Hu
Applications: IHC, IHC-P, KO, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-24951
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
DRA00B
Species: Hu
Applications: ELISA
NBP2-44751
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P

Publications for DGCR6 Antibody (NBP2-84003) (0)

There are no publications for DGCR6 Antibody (NBP2-84003).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGCR6 Antibody (NBP2-84003) (0)

There are no reviews for DGCR6 Antibody (NBP2-84003). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGCR6 Antibody (NBP2-84003) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DGCR6 Products

Bioinformatics Tool for DGCR6 Antibody (NBP2-84003)

Discover related pathways, diseases and genes to DGCR6 Antibody (NBP2-84003). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGCR6 Antibody (NBP2-84003)

Discover more about diseases related to DGCR6 Antibody (NBP2-84003).
 

Pathways for DGCR6 Antibody (NBP2-84003)

View related products by pathway.

PTMs for DGCR6 Antibody (NBP2-84003)

Learn more about PTMs related to DGCR6 Antibody (NBP2-84003).

Blogs on DGCR6

There are no specific blogs for DGCR6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGCR6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGCR6