We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Dematin Recombinant Protein Antigen

Images

 
There are currently no images for Dematin Recombinant Protein Antigen (NBP3-17829PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dematin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dematin

Source: E. coli

Amino Acid Sequence: DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EPB49
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17829.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dematin Recombinant Protein Antigen

  • dematin
  • DMTFLJ78462
  • erythrocyte membrane protein band 4.9 (dematin)
  • Erythrocyte membrane protein band 4.9
  • FLJ98848

Background

Caldesmon, filamin 1, nebulin, villin, plastin, ADF, gelsolin, Dematin, and cofilin are differentially expressed actin binding proteins. Dematin is a bundling protein of the erythrocyte membrane skeleton. Dematin is localized to the spectrin-actin junctions, and its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase. It may also play a role in the regulation of cell shape, implying a role in tumorigenesis. Dematin is a trimeric protein containing two subunits of 48 kDa and one subunit of 52 kDa. It is localized to the heart, brain, lung, skeletal muscle, and kidney. The Dematin gene is located on human chromosome 8p21.1, a region frequently deleted in prostate cancer, and mouse chromosome 14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84071
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
MAB7509
Species: Hu
Applications: IHC, KO, WB
H00002035-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-31572
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13628
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94196
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00001760-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-16396
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB

Publications for Dematin Recombinant Protein Antigen (NBP3-17829PEP) (0)

There are no publications for Dematin Recombinant Protein Antigen (NBP3-17829PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dematin Recombinant Protein Antigen (NBP3-17829PEP) (0)

There are no reviews for Dematin Recombinant Protein Antigen (NBP3-17829PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dematin Recombinant Protein Antigen (NBP3-17829PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dematin Products

Blogs on Dematin

There are no specific blogs for Dematin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dematin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB49