Delta 1 Tubulin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Delta 1 Tubulin Antibody [NBP1-87391] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry: Delta 1 Tubulin Antibody [NBP1-87391] - Staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: Delta 1 Tubulin Antibody [NBP1-87391] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm and golgi apparatus. Antibody staining is shown ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Delta 1 Tubulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VFQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLRQMLISNAKMEEGID
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Delta 1 Tubulin Protein (NBP1-87391PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Delta 1 Tubulin Antibody

  • delta-tubulin
  • TUBDFLJ12709
  • tubulin delta chain
  • tubulin, delta 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37244
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-13367
Species: Hu
Applications: IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-58195
Species: Hu
Applications: ICC/IF
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF755
Species: Mu
Applications: WB, Block
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83754
Species: Hu
Applications: IHC, IHC-P
NBP2-20605
Species: Hu
Applications: WB, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-19041
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-86649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-03274
Species: Hu, Rt, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87391
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Delta 1 Tubulin Antibody (NBP1-87391) (0)

There are no publications for Delta 1 Tubulin Antibody (NBP1-87391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Delta 1 Tubulin Antibody (NBP1-87391) (0)

There are no reviews for Delta 1 Tubulin Antibody (NBP1-87391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Delta 1 Tubulin Antibody (NBP1-87391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Delta 1 Tubulin Products

Bioinformatics Tool for Delta 1 Tubulin Antibody (NBP1-87391)

Discover related pathways, diseases and genes to Delta 1 Tubulin Antibody (NBP1-87391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Delta 1 Tubulin Antibody (NBP1-87391)

Discover more about diseases related to Delta 1 Tubulin Antibody (NBP1-87391).

Blogs on Delta 1 Tubulin

There are no specific blogs for Delta 1 Tubulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Delta 1 Tubulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBD1