DDX60L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DDX60L Antibody [NBP2-56253] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX60L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKWNDMMEEAYQTLFLLQHLWSEGSDIQR
Specificity
Specificity of human DDX60L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX60L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX60L Recombinant Protein Antigen (NBP2-56253PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DDX60L Antibody

  • probable ATP-dependent RNA helicase DDX60-like
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67510
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15020
Species: Hu
Applications: WB, ICC/IF
NB300-143
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2147
Species: Mu
Applications: WB, Simple Western, IHC
5255-EN
Species: Hu
NBP1-81473
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91826
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010253-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for DDX60L Antibody (NBP2-56253) (0)

There are no publications for DDX60L Antibody (NBP2-56253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX60L Antibody (NBP2-56253) (0)

There are no reviews for DDX60L Antibody (NBP2-56253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DDX60L Antibody (NBP2-56253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX60L Antibody (NBP2-56253)

Discover related pathways, diseases and genes to DDX60L Antibody (NBP2-56253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX60L Antibody (NBP2-56253)

Discover more about diseases related to DDX60L Antibody (NBP2-56253).
 

Pathways for DDX60L Antibody (NBP2-56253)

View related products by pathway.

Blogs on DDX60L

There are no specific blogs for DDX60L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX60L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX60L