DDX50 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX50 Antibody [NBP2-55077] - Immunohistochemical staining of human oral mucosa shows nuclear positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX50 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX50 Antibody - BSA Free (NBP2-55077) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX50
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DDX50 Antibody - BSA Free

• ATP-dependent RNA helicase DDX50
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
• DEAD box protein 50
• EC 3.6.1
• EC 3.6.4.13
• GU2
• GUB
• gu-beta
• MGC3199
• Nucleolar protein Gu2
• RH-II/GuB
• RNA helicase II/Gu beta

Background

DDX50, also known as ATP-dependent RNA helicase DDX50, is an 82.6 kDa 737 amino acid protein and is involved in cellular growth and division as a member of the DEAD box protein family. The protein is being studied for involvement in malaria. While involved in ATP and RNA binding pathways, the protein interacts with other proteins such as MED19, SRRM2, UBC, ESR2, and STAU1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX50