DDX50 Antibody


Immunohistochemistry-Paraffin: DDX50 Antibody [NBP2-55077] - Immunohistochemical staining of human oral mucosa shows nuclear positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

DDX50 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
Specificity of human DDX50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DDX50 Antibody

  • ATP-dependent RNA helicase DDX50
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
  • DEAD box protein 50
  • EC 3.6.1
  • EC
  • GU2
  • GUB
  • gu-beta
  • MGC3199
  • Nucleolar protein Gu2
  • RH-II/GuB
  • RNA helicase II/Gu beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for DDX50 Antibody (NBP2-55077) (0)

There are no publications for DDX50 Antibody (NBP2-55077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX50 Antibody (NBP2-55077) (0)

There are no reviews for DDX50 Antibody (NBP2-55077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DDX50 Antibody (NBP2-55077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX50 Antibody (NBP2-55077)

Discover related pathways, diseases and genes to DDX50 Antibody (NBP2-55077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX50 Antibody (NBP2-55077)

Discover more about diseases related to DDX50 Antibody (NBP2-55077).

Pathways for DDX50 Antibody (NBP2-55077)

View related products by pathway.

PTMs for DDX50 Antibody (NBP2-55077)

Learn more about PTMs related to DDX50 Antibody (NBP2-55077).

Blogs on DDX50

There are no specific blogs for DDX50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDX50 Antibody and receive a gift card or discount.


Gene Symbol DDX50