DCUN1D2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DCUN1D2 Antibody [NBP1-88397] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: DCUN1D2 Antibody [NBP1-88397] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/ Immunofluorescence: DCUN1D2 Antibody [NBP1-88397] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCUN1D2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCUN1D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCUN1D2 Protein (NBP1-88397PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCUN1D2 Antibody

  • C13orf17
  • chromosome 13 open reading frame 17
  • DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
  • DCN1-like protein 2
  • DCUN1 domain-containing protein 2
  • DCUN1L2
  • Defective in cullin neddylation protein 1-like protein 2
  • FLJ10704
  • FLJ20092

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP1-87518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58455
Species: Hu
Applications: ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for DCUN1D2 Antibody (NBP1-88397) (0)

There are no publications for DCUN1D2 Antibody (NBP1-88397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCUN1D2 Antibody (NBP1-88397) (0)

There are no reviews for DCUN1D2 Antibody (NBP1-88397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DCUN1D2 Antibody (NBP1-88397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCUN1D2 Products

Bioinformatics Tool for DCUN1D2 Antibody (NBP1-88397)

Discover related pathways, diseases and genes to DCUN1D2 Antibody (NBP1-88397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCUN1D2 Antibody (NBP1-88397)

Discover more about diseases related to DCUN1D2 Antibody (NBP1-88397).
 

Pathways for DCUN1D2 Antibody (NBP1-88397)

View related products by pathway.

PTMs for DCUN1D2 Antibody (NBP1-88397)

Learn more about PTMs related to DCUN1D2 Antibody (NBP1-88397).

Blogs on DCUN1D2

There are no specific blogs for DCUN1D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCUN1D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCUN1D2