Recombinant Human DARS2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DARS2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-645 of Human DARS2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DARS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DARS2 Protein

  • aspartate tRNA ligase 2, mitochondrial
  • Aspartate--tRNA ligase
  • aspartyl-tRNA synthetase 2, mitochondrial
  • aspartyl-tRNA synthetase, mitochondrial
  • AspRS
  • ASPRS. LBSL
  • EC 6.1.1
  • EC 6.1.1.12
  • FLJ10514
  • LBSL
  • MT-ASPRS
  • RP3-383J4.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56375
Species: Hu
Applications: ICC/IF
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DARS2 Recombinant Protein (H00055157-P01) (0)

There are no publications for DARS2 Recombinant Protein (H00055157-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DARS2 Recombinant Protein (H00055157-P01) (0)

There are no reviews for DARS2 Recombinant Protein (H00055157-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DARS2 Recombinant Protein (H00055157-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DARS2 Products

Bioinformatics Tool for DARS2 Recombinant Protein (H00055157-P01)

Discover related pathways, diseases and genes to DARS2 Recombinant Protein (H00055157-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DARS2 Recombinant Protein (H00055157-P01)

Discover more about diseases related to DARS2 Recombinant Protein (H00055157-P01).
 

Pathways for DARS2 Recombinant Protein (H00055157-P01)

View related products by pathway.

Research Areas for DARS2 Recombinant Protein (H00055157-P01)

Find related products by research area.

Blogs on DARS2

There are no specific blogs for DARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DARS2 Antibody
NBP1-83854
NARS2 Antibody
NBP1-82077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DARS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DARS2