Recombinant Human DARPP-32 GST (N-Term) Protein

Images

 
SDS-Page: DARPP32 Recombinant Protein [H00084152-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human DARPP-32 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-168 of Human PPP1R1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PPP1R1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunoaffinity Purification
  • Protein Array 1:100-1:2000
  • Western Blot 1:100-1:2000
Theoretical MW
44.22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DARPP-32 GST (N-Term) Protein

  • DARPP32
  • DARPP-32
  • PPP1R1B
  • protein phosphatase 1, regulatory (inhibitor) subunit 1B
  • regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32)

Background

Midbrain dopaminergic neurons play a critical role in multiple brain functions, and abnormal signaling through dopaminergic pathways has been implicated in several major neurologic and psychiatric disorders. One well-studied target for the actions of dopamine is DARPP32. In the densely dopamine- and glutamate-innervated rat caudate-putamen, DARPP32 is expressed in medium-sized spiny neurons (Ouimet and Greengard, 1990 [PubMed 2191086]) that also express dopamine D1 receptors (Walaas and Greengard, 1984 [PubMed 6319627]). The function of DARPP32 seems to be regulated by receptor stimulation. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions (Halpain et al., 1990 [PubMed 2153935]). Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32 (Walaas and Greengard, 1984 [PubMed 6319627]); phosphorylated DARPP32 is a potent protein phosphatase-1 (see MIM 176875) inhibitor (Hemmings et al., 1984 [PubMed 6087160]). NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32 (Halpain et al., 1990 [PubMed 2153935]).[supplied by OMIM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-16213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-22399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00084152-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for DARPP-32 Recombinant Protein (H00084152-P01) (0)

There are no publications for DARPP-32 Recombinant Protein (H00084152-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DARPP-32 Recombinant Protein (H00084152-P01) (0)

There are no reviews for DARPP-32 Recombinant Protein (H00084152-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DARPP-32 Recombinant Protein (H00084152-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DARPP-32 Products

Research Areas for DARPP-32 Recombinant Protein (H00084152-P01)

Find related products by research area.

Blogs on DARPP-32

There are no specific blogs for DARPP-32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DARPP-32 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R1B