We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DARPP-32 Recombinant Protein Antigen

Images

 
There are currently no images for DARPP-32 Protein (NBP2-38908PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DARPP-32 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R1B.

Source: E. coli

Amino Acid Sequence: EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38908.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DARPP-32 Recombinant Protein Antigen

  • DARPP32
  • DARPP-32
  • PPP1R1B
  • protein phosphatase 1, regulatory (inhibitor) subunit 1B
  • regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32)

Background

DARPP-32, a dopamine (DA) and cAMP-regulated ~32k phosphoprotein, is associated with dopaminoceptive neurons bearing D-1 receptors in the basal ganglia. The protein inhibits protein phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP is thought to play a critical role in the regulation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47877
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-16213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-22399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-38908PEP
Species: Hu
Applications: AC

Publications for DARPP-32 Protein (NBP2-38908PEP) (0)

There are no publications for DARPP-32 Protein (NBP2-38908PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DARPP-32 Protein (NBP2-38908PEP) (0)

There are no reviews for DARPP-32 Protein (NBP2-38908PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DARPP-32 Protein (NBP2-38908PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DARPP-32 Products

Research Areas for DARPP-32 Protein (NBP2-38908PEP)

Find related products by research area.

Blogs on DARPP-32

There are no specific blogs for DARPP-32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DARPP-32 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R1B