DARPP-32 Antibody

Western Blot: DARPP-32 Antibody [H00084152-B01P] - Analysis of PPP1R1B expression in transfected 293T cell line by PPP1R1B polyclonal antibody. Lane 1: PPP1R1B transfected lysate(22.44 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

DARPP-32 Antibody Summary

• Immunogen: PPP1R1B (NP_115568.2, 1 a.a. - 204 a.a.) full-length human protein. MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
• Marker: Neuronal Marker
• Specificity: PPP1R1B - protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PPP1R1B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DARPP-32 Antibody

• DARPP32
• DARPP-32
• PPP1R1B
• protein phosphatase 1, regulatory (inhibitor) subunit 1B
• regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32)

Background

Midbrain dopaminergic neurons play a critical role in multiple brain functions, and abnormal signaling through dopaminergic pathways has been implicated in several major neurologic and psychiatric disorders. One well-studied target for the actions of dopamine is DARPP32. In the densely dopamine- and glutamate-innervated rat caudate-putamen, DARPP32 is expressed in medium-sized spiny neurons (Ouimet and Greengard, 1990 [PubMed 2191086]) that also express dopamine D1 receptors (Walaas and Greengard, 1984 [PubMed 6319627]). The function of DARPP32 seems to be regulated by receptor stimulation. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions (Halpain et al., 1990 [PubMed 2153935]). Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32 (Walaas and Greengard, 1984 [PubMed 6319627]); phosphorylated DARPP32 is a potent protein phosphatase-1 (see MIM 176875) inhibitor (Hemmings et al., 1984 [PubMed 6087160]). NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32 (Halpain et al., 1990 [PubMed 2153935]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for DARPP-32 Antibody (H00084152-B01P). (Showing 1 - 1 of 1 FAQ).

1. I am inquiring about some antibodies that you have listed on your website for DARPP-32: H00084152-M05, H00084152-M03, H00084152-B01P and H00084152-B01. We are limited by the fact that we need a DARPP-32 antibody with a mouse host, and these are the only commercially available ones that I can find. However, we are wanting to use these for immunofluorescence (immunohistochemistry), and these antibodies, according to your website, have not been used in this type of application, at least not yet. Have any of these been tested for immunofluorescence yet, and if so, at what concentration?
   • None of these antibodies have been tested in immunofluorescence yet, however this does not mean they will not work for IF. If you would like to test any of these antibodies in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward program to you. Please see this link for details of how our Innovators Reward Program.

Bioinformatics

• Gene Symbol: PPP1R1B
• Entrez:
  • 84152(Human)
• Uniprot:
  • NP_115568.2(Human)