DARPP-32 Antibody (1A3) Summary
| Immunogen |
PPP1R1B (AAH01519, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
| Marker |
Neuronal Marker |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PPP1R1B |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DARPP-32 Antibody (1A3)
Background
The 32kDa dopamine and cyclic adenosine 3',5'-monophosphate-regulated phosphoprotein (DARPP-32) can either function as a serine/threonine kinase or as a serine/threonine phosphatase depending upon which particular amino acid residue is phosphorylated (1). When phosphorylated by protein kinase A (PKA) at threonine 34, DARPP-32 becomes a potent inhibitor of protein phosphatase-1 (2-3). Alternatively, when phosphorylated at threonine 75 by cyclin-dependent kinase 5(Cdk5), DARPP-32 is converted into an inhibitor of PKA (1). DARPP-32 and truncated DARPP (t-DARPP) are overexpressed in gastric cancers (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for DARPP-32 Antibody (H00084152-M05) (0)
There are no publications for DARPP-32 Antibody (H00084152-M05).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DARPP-32 Antibody (H00084152-M05) (0)
There are no reviews for DARPP-32 Antibody (H00084152-M05).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DARPP-32 Antibody (H00084152-M05). (Showing 1 - 1 of 1 FAQ).
-
I am inquiring about some antibodies that you have listed on your website for DARPP-32: H00084152-M05, H00084152-M03, H00084152-B01P and H00084152-B01. We are limited by the fact that we need a DARPP-32 antibody with a mouse host, and these are the only commercially available ones that I can find. However, we are wanting to use these for immunofluorescence (immunohistochemistry), and these antibodies, according to your website, have not been used in this type of application, at least not yet. Have any of these been tested for immunofluorescence yet, and if so, at what concentration?
- None of these antibodies have been tested in immunofluorescence yet, however this does not mean they will not work for IF. If you would like to test any of these antibodies in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward program to you. Please see this link for details of how our Innovators Reward Program.
Secondary Antibodies
| |
Isotype Controls
|
Additional DARPP-32 Products
Research Areas for DARPP-32 Antibody (H00084152-M05)
Find related products by research area.
|
Blogs on DARPP-32