DAPP1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DAPP1 Antibody - BSA Free (NBP2-33452) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG |
| Predicted Species |
Mouse (96%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DAPP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DAPP1 Antibody - BSA Free
Background
B cell adapter molecule (BAM32) is also designated a dual adapter for phosphotyrosine and 3-phosphotyrosine, and 3-phosphoinositide (DAPP1) or B lymphocyte adapter protein. BAM32 is a B cell-associated adapter that is crucial for B cell antigen receptor signaling regulation. BAM32 interacts with Ptdlns and PLC gamma2 and, upon B cell activation, the protein is phosphorylated on tyrosine residues. It is a mainly cytoplasmic protein that can translocate to the cell membrane after cell stimulation. BAM32, which contains one PH domain and one SH2 domain, is primarily expressed in placenta and lung tissues, but can also be detected in heart, liver, pancreas and brain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Publications for DAPP1 Antibody (NBP2-33452) (0)
There are no publications for DAPP1 Antibody (NBP2-33452).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DAPP1 Antibody (NBP2-33452) (0)
There are no reviews for DAPP1 Antibody (NBP2-33452).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DAPP1 Antibody (NBP2-33452) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DAPP1 Products
Research Areas for DAPP1 Antibody (NBP2-33452)
Find related products by research area.
|
Blogs on DAPP1