DAP Kinase 1 Recombinant Protein Antigen

Images

 
There are currently no images for DAP Kinase 1 Protein (NBP2-38580PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DAP Kinase 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAPK1.

Source: E. coli

Amino Acid Sequence: HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DAPK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38580.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAP Kinase 1 Recombinant Protein Antigen

  • DAP Kinase 1
  • DAPK
  • DAPK1
  • DAPKDAP kinase 1
  • death-associated protein kinase 1
  • DKFZp781I035
  • EC 2.7.11
  • EC 2.7.11.1

Background

DAPK1 (Death-associated protein kinase 1) is a calmodulin dependent serine/threonine serine kinase which functions as a positive mediator of gamma-interferon induced programmed cell death. DAPK1 expression is frequently lost in human carcinomas and B-cell leukemia, and lower levels of expression correlates with high rates of metastasis. The loss of DAPK expression provides a link between suppression of apoptosis and metastasis. DAPK1 is thought be involved in an early apoptotic checkpoint which eliminates premalignant cells from cancer formation. Studies in bladder cancer patients have also shown that hypermethylation of DAPK1 correlates to high recurrence rates and thus DAPK1 may be used as a prognostic marker. DAPK1 is also reportedly a molecular regulator of neuronal death in epilepsy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
973-TM
Species: Hu
Applications: InhibAct
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-87430
Species: Hu
Applications: IHC,  IHC-P
NB200-323
Species: Hu, Rt
Applications: WB
352-MS
Species: Hu
Applications: BA

Publications for DAP Kinase 1 Protein (NBP2-38580PEP) (0)

There are no publications for DAP Kinase 1 Protein (NBP2-38580PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP Kinase 1 Protein (NBP2-38580PEP) (0)

There are no reviews for DAP Kinase 1 Protein (NBP2-38580PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAP Kinase 1 Protein (NBP2-38580PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP Kinase 1 Products

Research Areas for DAP Kinase 1 Protein (NBP2-38580PEP)

Find related products by research area.

Blogs on DAP Kinase 1

There are no specific blogs for DAP Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DAP Kinase 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DAPK1