DAGLB Antibody

Images

 
Western Blot: DAGLB Antibody [NBP2-57542] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: DAGLB Antibody [NBP2-57542] - Staining of human cell line HaCaT shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DAGLB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIA
Specificity
Specificity of human DAGLB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAGLB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DAGLB Recombinant Protein Antigen (NBP2-57542PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DAGLB Antibody

  • beta
  • DAGLB
  • DAGLBETA
  • diacylglycerol lipase beta
  • diacylglycerol lipase
  • FLJ33624
  • FLJ33909
  • KCCR13L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-126
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF2364
Species: Hu
Applications: WB, IHC
NB600-533
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IP
NBP1-80116
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-03329
Species: Mu, Rt
Applications: WB, IHC
NB100-1285
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
NBP1-83109
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57800
Species: Hu, Mu
Applications: WB, ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP2-57542
Species: Hu
Applications: WB, ICC/IF

Publications for DAGLB Antibody (NBP2-57542) (0)

There are no publications for DAGLB Antibody (NBP2-57542).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAGLB Antibody (NBP2-57542) (0)

There are no reviews for DAGLB Antibody (NBP2-57542). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DAGLB Antibody (NBP2-57542) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DAGLB Products

Bioinformatics Tool for DAGLB Antibody (NBP2-57542)

Discover related pathways, diseases and genes to DAGLB Antibody (NBP2-57542). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAGLB Antibody (NBP2-57542)

Discover more about diseases related to DAGLB Antibody (NBP2-57542).

Blogs on DAGLB

There are no specific blogs for DAGLB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAGLB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAGLB