DAGLB Antibody

Images

 
Western Blot: DAGLB Antibody [NBP1-69662] - This Anti-DAGLB antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DAGLB Antibody Summary

Immunogen
Synthetic peptides corresponding to DAGLB(diacylglycerol lipase, beta) The peptide sequence was selected from the middle region of DAGLB. Peptide sequence STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAGLB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DAGLB and was validated on Western blot.
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DAGLB Antibody

  • beta
  • DAGLB
  • DAGLBETA
  • diacylglycerol lipase beta
  • diacylglycerol lipase
  • FLJ33624
  • FLJ33909
  • KCCR13L

Background

DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF2364
Species: Hu
Applications: WB, IHC
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-80116
Species: Hu
Applications: WB, IHC, IHC-P
NB100-88147
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF6366
Species: Hu
Applications: WB, IHC
NBP2-57800
Species: Hu
Applications: ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69662
Species: Hu
Applications: WB

Publications for DAGLB Antibody (NBP1-69662) (0)

There are no publications for DAGLB Antibody (NBP1-69662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAGLB Antibody (NBP1-69662) (0)

There are no reviews for DAGLB Antibody (NBP1-69662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAGLB Antibody (NBP1-69662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAGLB Products

Bioinformatics Tool for DAGLB Antibody (NBP1-69662)

Discover related pathways, diseases and genes to DAGLB Antibody (NBP1-69662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAGLB Antibody (NBP1-69662)

Discover more about diseases related to DAGLB Antibody (NBP1-69662).

Blogs on DAGLB

There are no specific blogs for DAGLB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAGLB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAGLB
Uniprot