Cystatin-8 Antibody - Azide and BSA Free

Western Blot: Cystatin-8 Antibody [H00010047-B01P] - Analysis of CST8 expression in transfected 293T cell line by CST8 polyclonal antibody. Lane 1: CST8 transfected lysate(9.9 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cystatin-8 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Cystatin-8 Antibody - Azide and BSA Free (H00010047-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CST8 (AAH69536.1, 1 a.a. - 90 a.a.) full-length human protein. MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
• Specificity: CST8 - cystatin 8 (cystatin-related epididymal specific),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CST8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cystatin-8 Antibody - Azide and BSA Free

• CRESCystatin-related epididymal spermatogenic protein
• cystatin 8 (cystatin-related epididymal specific)
• cystatin-8
• cystatin-related epididymal-specific

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing identified in mouse is suggested in human based on EST evidence but the full-length nature of putative variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CST8
• Entrez:
  • 10047(Human)