CYP2A7 Antibody


Western Blot: CYP2A7 Antibody [NBP1-69676] - This Anti-CYP2A7 antibody was used in Western Blot of ACHN tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CYP2A7 Antibody Summary

Synthetic peptides corresponding to CYP2A7(cytochrome P450, family 2, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP2A7. Peptide sequence KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP2A7 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP2A7 Antibody

  • CPA7
  • CPAD
  • CYP2A
  • cytochrome P450 2A7
  • Cytochrome P450 IIA4
  • cytochrome P450, family 2, subfamily A, polypeptide 7
  • cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 7
  • EC
  • P450-IIA4


This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: WB

Publications for CYP2A7 Antibody (NBP1-69676) (0)

There are no publications for CYP2A7 Antibody (NBP1-69676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP2A7 Antibody (NBP1-69676) (0)

There are no reviews for CYP2A7 Antibody (NBP1-69676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP2A7 Antibody (NBP1-69676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CYP2A7 Products

Bioinformatics Tool for CYP2A7 Antibody (NBP1-69676)

Discover related pathways, diseases and genes to CYP2A7 Antibody (NBP1-69676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP2A7 Antibody (NBP1-69676)

Discover more about diseases related to CYP2A7 Antibody (NBP1-69676).

Pathways for CYP2A7 Antibody (NBP1-69676)

View related products by pathway.

PTMs for CYP2A7 Antibody (NBP1-69676)

Learn more about PTMs related to CYP2A7 Antibody (NBP1-69676).

Blogs on CYP2A7

There are no specific blogs for CYP2A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP2A7 Antibody and receive a gift card or discount.


Gene Symbol CYP2A7