Cyclophilin A Antibody (1F4-1B5)

Images

 
Western Blot: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - PPIA monoclonal antibody (M01), clone 1F4-1B5 Analysis of PPIA expression in Jurkat.
Western Blot: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - Analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5.Lane 1: PPIA transfected lysate(18 KDa).Lane 2: ...read more
ELISA: Cyclophilin A Antibody (1F4-1B5) [H00005478-M01] - Detection limit for recombinant GST tagged PPIA is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F4-1B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cyclophilin A Antibody (1F4-1B5) Summary

Immunogen
PPIA (AAH00689.1, 1 a.a. - 165 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Specificity
PPIA - peptidylprolyl isomerase A (cyclophilin A)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPIA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00005478-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclophilin A Antibody (1F4-1B5)

  • Cyclophilin A
  • Cyclosporin A-binding protein
  • CYPA
  • CYPAMGC12404
  • CYPH
  • EC 5.2.1.8
  • MGC117158
  • MGC23397
  • peptidyl-prolyl cis-trans isomerase A
  • peptidylprolyl isomerase A (cyclophilin A)
  • PPIA
  • PPIase A
  • Rotamase A
  • Rotamase
  • T cell cyclophilin

Background

This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005478-M01
Species: Hu
Applications: WB, ELISA
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NB100-56516
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00005478-M01
Species: Hu
Applications: WB, ELISA

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclophilin A Antibody (H00005478-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclophilin A Products

Bioinformatics Tool for Cyclophilin A Antibody (H00005478-M01)

Discover related pathways, diseases and genes to Cyclophilin A Antibody (H00005478-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclophilin A Antibody (H00005478-M01)

Discover more about diseases related to Cyclophilin A Antibody (H00005478-M01).
 

Pathways for Cyclophilin A Antibody (H00005478-M01)

View related products by pathway.

PTMs for Cyclophilin A Antibody (H00005478-M01)

Learn more about PTMs related to Cyclophilin A Antibody (H00005478-M01).
 

Research Areas for Cyclophilin A Antibody (H00005478-M01)

Find related products by research area.

Blogs on Cyclophilin A

There are no specific blogs for Cyclophilin A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclophilin A Antibody (1F4-1B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIA
Entrez
OMIM
Uniprot