Cyclin J Antibody

Images

 
Western Blot: Cyclin J Antibody [NBP1-55418] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin J Antibody Summary

Immunogen
Synthetic peptides corresponding to CCNJ(cyclin J) Antibody(against the N terminal of CCNJ. Peptide sequence FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNJ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CCNJ and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cyclin J Antibody

  • bA690P14.1
  • cyclin J
  • cyclin-J
  • FLJ10895

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
NBP1-90071
Species: Eq, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-66778
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF2950
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-52193
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-59944
Species: Hu
Applications: WB
MAB4446
Species: Hu, Mu, Rt
Applications: WB
AF3757
Species: Hu
Applications: ICC, WB
H00001879-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IP, KD, S-ELISA, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF981
Species: Hu
Applications: ICC, IHC, Neut, WB

Publications for Cyclin J Antibody (NBP1-55418) (0)

There are no publications for Cyclin J Antibody (NBP1-55418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin J Antibody (NBP1-55418) (0)

There are no reviews for Cyclin J Antibody (NBP1-55418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclin J Antibody (NBP1-55418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin J Products

Bioinformatics Tool for Cyclin J Antibody (NBP1-55418)

Discover related pathways, diseases and genes to Cyclin J Antibody (NBP1-55418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin J Antibody (NBP1-55418)

Discover more about diseases related to Cyclin J Antibody (NBP1-55418).
 

Pathways for Cyclin J Antibody (NBP1-55418)

View related products by pathway.

Blogs on Cyclin J

There are no specific blogs for Cyclin J, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin J Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNJ
Uniprot