Cyclin J Antibody Summary
Immunogen |
Synthetic peptides corresponding to CCNJ(cyclin J) Antibody(against the N terminal of CCNJ.
Peptide sequence FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CCNJ |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against CCNJ and was validated on Western blot. |
Theoretical MW |
42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Cyclin J Antibody
Background
The function of this protein remains unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
Species: Eq, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: ChIP, ELISA, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Publications for Cyclin J Antibody (NBP1-55418) (0)
There are no publications for Cyclin J Antibody (NBP1-55418).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cyclin J Antibody (NBP1-55418) (0)
There are no reviews for Cyclin J Antibody (NBP1-55418).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cyclin J Antibody (NBP1-55418) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cyclin J Products
Bioinformatics Tool for Cyclin J Antibody (NBP1-55418)
Discover related pathways, diseases and genes to Cyclin J Antibody (NBP1-55418). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Cyclin J Antibody (NBP1-55418)
Discover more about diseases related to Cyclin J Antibody (NBP1-55418).
| | Pathways for Cyclin J Antibody (NBP1-55418)
View related products by pathway.
|
Blogs on Cyclin J