Cyclin G2 Antibody - BSA Free

Western Blot: Cyclin G2 Antibody [NBP1-79935] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Western Blot: Cyclin G2 Antibody [NBP1-79935] - Jurkat Cell Lysate 2.5ug/ml; Gel Concentration: 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Cyclin G2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human CCNG2. Peptide sequence MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCNG2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Cyclin G2 Antibody - BSA Free

• cyclin G2
• cyclin-G2

Background

The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Cyclin G2 Antibody (NBP1-79935). (Showing 1 - 1 of 1 FAQ).

1. Does this antibody work for pigs?
   • We have not yet tested our Cyclin G2 antibody NBP1-79935 for cross reactivity with the porcine protein yet. The immunogen sequence does share about 90% similarity to the uncharacterized porcine sequence http://www.uniprot.org/uniprot/F1RYS3, so there is a good chance the antibody will detect the pig protein.

Bioinformatics

• Gene Symbol: CCNG2
• Uniprot:
  • NP_004345(Human)