CXXC Finger Protein 11 Antibody

Images

 
Immunohistochemistry: CXXC Finger Protein 11 Antibody [NBP2-31015] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXXC Finger Protein 11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXXC Finger Protein 11 Protein (NBP2-31015PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXXC Finger Protein 11 Antibody

  • C2orf85
  • Chromosome 2 Open Reading Frame 85
  • CXXC11
  • CXXC-Type Zinc Finger Protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76491
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP2-14954
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NB100-74602
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-15135
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-76513
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00054620-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56630
Species: Hu
Applications: WB
NBP2-31015
Species: Hu
Applications: IHC, IHC-P

Publications for CXXC Finger Protein 11 Antibody (NBP2-31015) (0)

There are no publications for CXXC Finger Protein 11 Antibody (NBP2-31015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXXC Finger Protein 11 Antibody (NBP2-31015) (0)

There are no reviews for CXXC Finger Protein 11 Antibody (NBP2-31015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXXC Finger Protein 11 Antibody (NBP2-31015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXXC Finger Protein 11 Products

Bioinformatics Tool for CXXC Finger Protein 11 Antibody (NBP2-31015)

Discover related pathways, diseases and genes to CXXC Finger Protein 11 Antibody (NBP2-31015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CXXC Finger Protein 11

There are no specific blogs for CXXC Finger Protein 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXXC Finger Protein 11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTP5
Uniprot