CWC15 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CWC15. Peptide sequence: IKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CWC15 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for CWC15 Antibody - BSA Free
Background
CWC15, or Spliceosome-associated protein CWC15 homolog, consists of a 229 amino acid isoform that is 27 kDa, and is involved in stimulating pre-mRNA splicing during transcription. Current research is being conducted on CWC15 and its relation to a variety of diseases and disorders, including inclusion conjunctivitis, ADHD, conduct disorder, and laryngotracheitis. CWC15 has been linked to the mRNA splicing pathway, and it interacts with proteins such as CTNNBL1, CCT5, CDC5L, RBM17, and ARHGAP17.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IP, WB
Species: V
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for CWC15 Antibody (NBP2-84735) (0)
There are no publications for CWC15 Antibody (NBP2-84735).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CWC15 Antibody (NBP2-84735) (0)
There are no reviews for CWC15 Antibody (NBP2-84735).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CWC15 Antibody (NBP2-84735) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CWC15 Products
Blogs on CWC15