CSRP2BP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CSRP2BP Antibody [NBP2-57876] - Staining of human cell line Hep G2 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSRP2BP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH
Specificity
Specificity of human CSRP2BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KAT14
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CSRP2BP Recombinant Protein Antigen (NBP2-57876PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CSRP2BP Antibody

  • ADA2A-containing complex subunit 2
  • ATAC component 2 homolog
  • ATAC2CRP2BPKAT14
  • CRP2 binding partner
  • CRP2 binding protein
  • CRP2-binding partner
  • CSRP2 binding protein
  • CSRP2-binding protein
  • cysteine rich protein 2 binding protein
  • cysteine-rich protein 2-binding protein
  • dJ717M23.1
  • MGC15388
  • PRO1194

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11567
Species: Hu
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB2695
Species: Hu
Applications: WB
NB100-55310
Species: Hu, Mu
Applications: WB, IP
NB100-68209
Species: Hu
Applications: WB, IP
NBP2-94164
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-86955
Species: Hu
Applications: WB
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CSRP2BP Antibody (NBP2-57876) (0)

There are no publications for CSRP2BP Antibody (NBP2-57876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP2BP Antibody (NBP2-57876) (0)

There are no reviews for CSRP2BP Antibody (NBP2-57876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CSRP2BP Antibody (NBP2-57876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CSRP2BP Products

Bioinformatics Tool for CSRP2BP Antibody (NBP2-57876)

Discover related pathways, diseases and genes to CSRP2BP Antibody (NBP2-57876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP2BP Antibody (NBP2-57876)

Discover more about diseases related to CSRP2BP Antibody (NBP2-57876).

Blogs on CSRP2BP

There are no specific blogs for CSRP2BP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSRP2BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT14