CSN3 Antibody

Images

 
Western Blot: CSN3 Antibody [NBP1-69167] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSN3 Antibody Summary

Immunogen
Synthetic peptides corresponding to CSN3 (casein kappa) The peptide sequence was selected from the N terminal of CSN3. Peptide sequence MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CSN3 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CSN3 Antibody

  • casein kappa
  • casein, kappa
  • CASK
  • CSN10kappa-casein
  • CSNK
  • KCA

Background

Kappa-casein stabilizes micelle formation, preventing casein precipitation in milk.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2720
Species: Hu
Applications: WB, IHC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87715
Species: Hu
Applications: WB, IHC, IHC-P
H00001446-D01P
Species: Hu, Mu
Applications: WB
NBP1-90189
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB

Publications for CSN3 Antibody (NBP1-69167) (0)

There are no publications for CSN3 Antibody (NBP1-69167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSN3 Antibody (NBP1-69167) (0)

There are no reviews for CSN3 Antibody (NBP1-69167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSN3 Antibody (NBP1-69167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSN3 Products

Bioinformatics Tool for CSN3 Antibody (NBP1-69167)

Discover related pathways, diseases and genes to CSN3 Antibody (NBP1-69167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSN3 Antibody (NBP1-69167)

Discover more about diseases related to CSN3 Antibody (NBP1-69167).
 

Pathways for CSN3 Antibody (NBP1-69167)

View related products by pathway.

PTMs for CSN3 Antibody (NBP1-69167)

Learn more about PTMs related to CSN3 Antibody (NBP1-69167).

Blogs on CSN3

There are no specific blogs for CSN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSN3
Uniprot