Recombinant Human CSN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CSN1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-102 of Human GPS1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPS1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CSN1 Protein

  • COP9 signalosome complex subunit 1
  • COPS1JAB1-containing signalosome subunit 1
  • CSN1MGC71287
  • G protein pathway suppressor 1SGN1
  • GPS-1
  • Protein MFH
  • Signalosome subunit 1

Background

GPS1 - G protein pathway suppressor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-90189
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-2720
Species: Hu
Applications: WB, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-14970
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP1-85434
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CSN1 Partial Recombinant Protein (H00002873-Q01) (0)

There are no publications for CSN1 Partial Recombinant Protein (H00002873-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSN1 Partial Recombinant Protein (H00002873-Q01) (0)

There are no reviews for CSN1 Partial Recombinant Protein (H00002873-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSN1 Partial Recombinant Protein (H00002873-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CSN1 Products

Bioinformatics Tool for CSN1 Partial Recombinant Protein (H00002873-Q01)

Discover related pathways, diseases and genes to CSN1 Partial Recombinant Protein (H00002873-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSN1 Partial Recombinant Protein (H00002873-Q01)

Discover more about diseases related to CSN1 Partial Recombinant Protein (H00002873-Q01).
 

Pathways for CSN1 Partial Recombinant Protein (H00002873-Q01)

View related products by pathway.

PTMs for CSN1 Partial Recombinant Protein (H00002873-Q01)

Learn more about PTMs related to CSN1 Partial Recombinant Protein (H00002873-Q01).
 

Research Areas for CSN1 Partial Recombinant Protein (H00002873-Q01)

Find related products by research area.

Blogs on CSN1

There are no specific blogs for CSN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CSN1 Antibody
NB100-362

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CSN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPS1