CRY1 Antibody (2G4-1F6)

Images

 
Immunocytochemistry/ Immunofluorescence: CRY1 Antibody (2G4-1F6) [H00001407-M02] - Analysis of monoclonal antibody to CRY1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: CRY1 Antibody (2G4-1F6) [H00001407-M02] - Detection limit for recombinant GST tagged CRY1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G4-1F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRY1 Antibody (2G4-1F6) Summary

Immunogen
CRY1 (AAH30519, 1 a.a. - 586 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRY1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRY1 Antibody (2G4-1F6)

  • CRY1
  • cryptochrome 1 (photolyase-like)
  • Cryptochrome I
  • PHLL1
  • PHLL1cryptochrome-1
  • photolyase-like cryptochrome 1

Background

Various biochemical, physiological and behavioural processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/posttranslation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding flavoproteins that bear some homology to blue-light receptors and photolyases. In Drosophila, CRY is a photoreceptor for the circadian clock where it binds to the clock component TIM in a light-dependent fashion and blocks its function. Mammalian Cryptochrome 1 and Cryptochrome 2 function via light-independent interactions with circadian genes CLOCK and BMAL1, as well as with PER1, PER2, and TIM. They seem to act as light-independent components of the circadian clock and probably regulate Per1 transcriptional cycling via interactions with both the activator and its feedback inhibitors. Mutant mice not expressing the Cryptochrome 1 or Cryptochrome 2 protein display accelerated and delayed periodicity of locomotor activity, respectively. It appears that the combination of both proteins working together is essential to synchronize the organism to circadian phases. A critical balance between Cryptochrome 1 and Cryptochrome 2 is required for proper clock function; in complete darkness, double-mutant mice present with instantaneous arrhythmicity, indicating the absence of an internal circadian clock. Cryptochromes (Cry 1 and 2) are blue, ultraviolet-A photoreceptor pigment proteins that are involved circadian rhythm regulation in plants and animals. In mammals, Cry 1 and 2 expression oscillates with respect to the daily light-dark cycle in the suprachiasmatic nucleus of the hypothalamus. These proteins localize to the cell nucleus, interact with each of the Per proteins, and assist in the translocation of Per from the cytoplasm to nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00004867-D01P
Species: Hu, Mu
Applications: WB
AF4208
Species: Rt
Applications: WB
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP

Publications for Cryptochrome I Antibody (H00001407-M02) (0)

There are no publications for Cryptochrome I Antibody (H00001407-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cryptochrome I Antibody (H00001407-M02) (0)

There are no reviews for Cryptochrome I Antibody (H00001407-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cryptochrome I Antibody (H00001407-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRY1 Products

Bioinformatics Tool for Cryptochrome I Antibody (H00001407-M02)

Discover related pathways, diseases and genes to Cryptochrome I Antibody (H00001407-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cryptochrome I Antibody (H00001407-M02)

Discover more about diseases related to Cryptochrome I Antibody (H00001407-M02).
 

Pathways for Cryptochrome I Antibody (H00001407-M02)

View related products by pathway.

PTMs for Cryptochrome I Antibody (H00001407-M02)

Learn more about PTMs related to Cryptochrome I Antibody (H00001407-M02).
 

Research Areas for Cryptochrome I Antibody (H00001407-M02)

Find related products by research area.

Blogs on CRY1

There are no specific blogs for CRY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRY1 Antibody (2G4-1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRY1
Entrez
Uniprot