We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CRMP2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CRMP2 Protein [H00001808-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related CRMP2 Peptides and Proteins

Order Details


    • Catalog Number
      H00001808-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CRMP2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 470-571 of Human CRMP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DPYSL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRMP2 GST (N-Term) Protein

  • Collapsin response mediator protein 2
  • CRMP-2
  • CRMP2N2A3
  • DHPRP2
  • dihydropyrimidinase-like 2 long form
  • dihydropyrimidinase-like 2
  • dihydropyrimidinase-related protein 2
  • DRP2collapsin response mediator protein hCRMP-2
  • DRP-2ULIP-2
  • ULIP2
  • Unc-33-like phosphoprotein 2

Background

Collapsin response mediator proteins (CRMPs) are cytosolic phosphoproteins involved in neuronal differentiation and axonal guidance. CRMP2 was previously shown to mediate the repulsive effect of Sema3A on axons and to participate in axonal specification. The CRMPs appear to play a complex role in axon growth as well as microtubule dynamics and axon induction. CRMPs localize to the lamellipodia and filopodia of axonal growth cones, suggesting a role in axon guidance. Moreover, CRMP2 is upregulated after axotomy, and appears to increase the formation of axon-type processes from hippocampal neurons. CRMP2 has been reported to bind tubulin dimers directly and modulate microtubule assembly. CRMPs have also been implicated in the pathogenesis of a paraneoplastic neurologic syndrome. Interaction studies have implicated phospholipase D2 (PLD2), the cytosolic tyrosine kinase Fes, and intersectin in CRMP function. Hyperphosphorylation of CRMP2 is an early event in the progression of Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1250-S3
Species: Hu
Applications: BA, BA
NBP2-87213
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76651
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-33419
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-16148
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-13937
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP3-47733
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-85224
Species: Hu
Applications: IHC,  IHC-P, WB
H00001808-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for CRMP2 Partial Recombinant Protein (H00001808-Q01) (0)

There are no publications for CRMP2 Partial Recombinant Protein (H00001808-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRMP2 Partial Recombinant Protein (H00001808-Q01) (0)

There are no reviews for CRMP2 Partial Recombinant Protein (H00001808-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRMP2 Partial Recombinant Protein (H00001808-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRMP2 Products

Array H00001808-Q01

Research Areas for CRMP2 Partial Recombinant Protein (H00001808-Q01)

Find related products by research area.

Blogs on CRMP2

There are no specific blogs for CRMP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRMP2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYSL2