We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CRLR Recombinant Protein Antigen

Images

 
There are currently no images for CRLR Recombinant Protein Antigen (NBP2-58137PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CRLR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CALCRL.

Source: E. coli

Amino Acid Sequence: RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CALCRL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58137.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRLR Recombinant Protein Antigen

  • calcitonin gene-related peptide type 1 receptor
  • calcitonin receptor-like
  • CALCRL
  • CGRP type 1 receptor
  • CGRPR
  • CGRPRCRLRCalcitonin receptor-like receptor
  • CRLR

Background

Calcitonin receptor-like receptor (CRLR) is an Adrenomedullin Receptor that requires two additional proteins to function: a chaperone protein RAMP (receptor activity modifying protein) and the component protein RCP. The function of CRLR depends on its interaction with RAMP. When coexpressed with RAMP1, CRLR acts as a receptor for calcitonin gene-related peptide (CGRP). In contrast, when CRLR is coexpressed with either RAMP2 or RAMP3, it acts as a receptor for adrenomedullin. Activation of the receptor leads to an increase in intracellular cyclic AMP. CRLR mediates the vasorelaxation of arteries, suggesting a potential role for the receptor in reaction to injury, particularly in the treatment of pulmonary hypertension. CRLR expression has been reported in brain, lung, blood vessel, liver, and intestinal tract. ESTs have been isolated from B-Cell/lung/testis, bone marrow, embryo, lung, and synovium libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01853
Species: Hu, Pm
Applications: Flow, IHC,  IHC-P, WB
NBP2-94078
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP3-27994
Species: Hu
Applications: ELISA, Flow, Func
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-56490
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
AF6517
Species: Hu
Applications: WB
NBP1-77129
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP2-76733
Species: Hu
Applications: ELISA
NBP1-84495
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr,  IHC-P
NBP3-47238
Species: Hu, Mu
Applications: ELISA, IHC, , WB
NBP3-27861
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB

Publications for CRLR Recombinant Protein Antigen (NBP2-58137PEP) (0)

There are no publications for CRLR Recombinant Protein Antigen (NBP2-58137PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRLR Recombinant Protein Antigen (NBP2-58137PEP) (0)

There are no reviews for CRLR Recombinant Protein Antigen (NBP2-58137PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRLR Recombinant Protein Antigen (NBP2-58137PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRLR Products

Array NBP2-58137PEP

Research Areas for CRLR Recombinant Protein Antigen (NBP2-58137PEP)

Find related products by research area.

Blogs on CRLR

There are no specific blogs for CRLR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRLR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCRL