CrkRS Antibody (1H4)

Images

 
Immunocytochemistry/ Immunofluorescence: CrkRS Antibody (1H4) [H00051755-M01] - Analysis of monoclonal antibody to CRKRS on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: CrkRS Antibody (1H4) [H00051755-M01] - Detection limit for recombinant GST tagged CRKRS is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CrkRS Antibody (1H4) Summary

Immunogen
CRKRS (NP_057591, 1281 a.a. ~ 1380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
Specificity
CRKRS (1H4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CrkRS Antibody (1H4)

  • Cdc2-related kinase, arginine/serine-richCrkRS
  • Cell division cycle 2-related protein kinase 7
  • Cell division protein kinase 12
  • CRK7CDC2-related protein kinase 7
  • CRKR
  • CRKRS
  • cyclin-dependent kinase 12
  • EC 2.7.11
  • EC 2.7.11.23
  • hCDK12
  • KIAA0904EC 2.7.11.22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15345
Species: Hu, Mu, Rt
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
H00008621-M01
Species: Hu
Applications: ELISA, ICC/IF, Simple Western, WB
NBP1-06519
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00057018-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46218
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-14908
Species: Hu
Applications: ICC/IF, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-288
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP3-04502
Species: Hu
Applications: ICC/IF, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89996
Species: Hu
Applications: IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
1726-JG
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
H00051755-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for CrkRS Antibody (H00051755-M01) (0)

There are no publications for CrkRS Antibody (H00051755-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CrkRS Antibody (H00051755-M01) (0)

There are no reviews for CrkRS Antibody (H00051755-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CrkRS Antibody (H00051755-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CrkRS Products

Array H00051755-M01

Bioinformatics Tool for CrkRS Antibody (H00051755-M01)

Discover related pathways, diseases and genes to CrkRS Antibody (H00051755-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CrkRS Antibody (H00051755-M01)

Discover more about diseases related to CrkRS Antibody (H00051755-M01).
 

Pathways for CrkRS Antibody (H00051755-M01)

View related products by pathway.

PTMs for CrkRS Antibody (H00051755-M01)

Learn more about PTMs related to CrkRS Antibody (H00051755-M01).
 

Research Areas for CrkRS Antibody (H00051755-M01)

Find related products by research area.

Blogs on CrkRS

There are no specific blogs for CrkRS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CrkRS Antibody (1H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK12
Entrez
Uniprot