CRHBP Antibody (3D9)

Images

 
Immunoprecipitation: CRHBP Antibody (3D9) [H00001393-M01] - Analysis of CRHBP transfected lysate using anti-CRHBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRHBP MaxPab rabbit polyclonal ...read more
Sandwich ELISA: CRHBP Antibody (3D9) [H00001393-M01] - Detection limit for recombinant GST tagged CRHBP is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP, S-ELISA
Clone
3D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRHBP Antibody (3D9) Summary

Immunogen
CRHBP (AAH18038, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Specificity
CRHBP (3D9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRHBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRHBP Antibody (3D9)

  • corticotropin releasing hormone binding protein
  • corticotropin-releasing factor-binding protein
  • Corticotropin-releasing hormone-binding protein
  • CRFBP
  • CRFBPcorticotropin releasing hormone-binding protein
  • CRF-BPCRF-binding protein
  • CRHBP
  • CRH-BP

Background

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
9134-TN
Species: Hu
Applications: BA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
MAB7447
Species: Hu
Applications: IHC, WB
NB100-56485
Species: Bv, Ca, Ch, Hu, Ma, Mu, Rt
Applications: ICC/IF, Simple Western, WB
7570-GH
Species: Hu
Applications: EnzAct
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-88543
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF009
Species: Hu
Applications: IHC, WB
NBP3-12450
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, SB, WB
D6050
Species: Hu
Applications: ELISA
NB100-93444
Species: Hu
Applications: PEP-ELISA, WB
H00001393-M01
Species: Hu
Applications: ELISA, IP, S-ELISA

Publications for CRHBP Antibody (H00001393-M01) (0)

There are no publications for CRHBP Antibody (H00001393-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRHBP Antibody (H00001393-M01) (0)

There are no reviews for CRHBP Antibody (H00001393-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRHBP Antibody (H00001393-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRHBP Products

Bioinformatics Tool for CRHBP Antibody (H00001393-M01)

Discover related pathways, diseases and genes to CRHBP Antibody (H00001393-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRHBP Antibody (H00001393-M01)

Discover more about diseases related to CRHBP Antibody (H00001393-M01).
 

Pathways for CRHBP Antibody (H00001393-M01)

View related products by pathway.

PTMs for CRHBP Antibody (H00001393-M01)

Learn more about PTMs related to CRHBP Antibody (H00001393-M01).
 

Research Areas for CRHBP Antibody (H00001393-M01)

Find related products by research area.

Blogs on CRHBP

There are no specific blogs for CRHBP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRHBP Antibody (3D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRHBP
Entrez
Uniprot