Creatine Kinase, Muscle/CKMM Antibody (1E3)

Images

 
Western Blot: Creatine Kinase, Muscle/CKMM Antibody (1E3) [H00001158-M02] - CKM monoclonal antibody (M02), clone 1E3 Analysis of CKM expression in IMR-32.
Immunocytochemistry/ Immunofluorescence: Creatine Kinase, Muscle/CKMM Antibody (1E3) [H00001158-M02] - Analysis of monoclonal antibody to CKM on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Creatine Kinase, Muscle/CKMM Antibody (1E3) [H00001158-M02] - Creatine Kinase, Muscle/CKMM Antibody (1E3) [H00001158-M02] - Detection limit for recombinant GST tagged CKM is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Creatine Kinase, Muscle/CKMM Antibody (1E3) Summary

Immunogen
CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Specificity
CKM - creatine kinase, muscle
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CKM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Creatine Kinase, Muscle/CKMM Antibody (1E3)

  • CKM
  • CKMM
  • CKMMcreatine kinase M-type
  • Creatine Kinase Isoenzyme
  • Creatine kinase M chain
  • Creatine Kinase MM
  • creatine kinase, muscle
  • creatine kinase-M
  • EC 2.7.3
  • EC 2.7.3.2
  • M-CK

Background

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6967
Species: Hu
Applications: WB
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15356
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-04676
Species: Hu, Mu, Rt, Po, Gt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92825
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Ma-Op, Pm
Applications: WB, IHC, IHC-P
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02) (0)

There are no publications for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02) (0)

There are no reviews for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Creatine Kinase, Muscle/CKMM Products

Bioinformatics Tool for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)

Discover related pathways, diseases and genes to Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)

Discover more about diseases related to Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).
 

Pathways for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)

View related products by pathway.

PTMs for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)

Learn more about PTMs related to Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).

Blogs on Creatine Kinase, Muscle/CKMM

There are no specific blogs for Creatine Kinase, Muscle/CKMM, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Creatine Kinase, Muscle/CKMM Antibody (1E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CKM
Entrez
OMIM
Uniprot