Creatine Kinase, Muscle/CKMM Antibody (1E3) Summary
Immunogen |
CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
Specificity |
CKM - creatine kinase, muscle |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CKM |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Creatine Kinase, Muscle/CKMM Antibody (1E3)
Background
The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Publications for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02) (0)
There are no publications for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02) (0)
There are no reviews for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Creatine Kinase, Muscle/CKMM Products
Bioinformatics Tool for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)
Discover related pathways, diseases and genes to Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)
Discover more about diseases related to Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).
| | Pathways for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)
View related products by pathway.
|
PTMs for Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02)
Learn more about PTMs related to Creatine Kinase, Muscle/CKMM Antibody (H00001158-M02).
|
Blogs on Creatine Kinase, Muscle/CKMM